PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30111.m000703
Common NameLOC8285998, RCOM_1399160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family LBD
Protein Properties Length: 201aa    MW: 21871.9 Da    PI: 4.5837
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30111.m000703genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601376.7e-43401391100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+a+la+
  30111.m000703  40 PCAACKILRRRCADKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEASARIRDPVYGCAGAICQLQKQVNELQAQLAK 135
                    7*********************************************************************************************** PP

         DUF260  97 lkee 100
                    +++e
  30111.m000703 136 AQAE 139
                    9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.13439140IPR004883Lateral organ boundaries, LOB
PfamPF031954.3E-4340137IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MDCSEAIATI SANSSSPSLS NSPTSSSSPP LTPAPVILSP CAACKILRRR CADKCVLAPY  60
FPPTEPAKFT IAHRVFGASN IIKFLQELPE SQRADAVSSM VYEASARIRD PVYGCAGAIC  120
QLQKQVNELQ AQLAKAQAEV VNMQCQQANL MALIYMEMAQ SPQQSSEQSI DDFITTPQSY  180
QSNPCFLDES NLGTMWEPLW T
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002526340.11e-146PREDICTED: LOB domain-containing protein 1
SwissprotQ9SK081e-78LBD11_ARATH; LOB domain-containing protein 11
TrEMBLB9SK211e-146B9SK21_RICCO; LOB domain-containing protein, putative
STRINGVIT_06s0004g03330.t012e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.14e-72LOB domain-containing protein 11